PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim04g074700.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 311aa    MW: 35254.8 Da    PI: 4.6908
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim04g074700.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.94.1e-1954106456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         ++++  +q+++Le+ Fe +++++ +++ ++A++lgL+ rq+ +WFqNrRa++k
  Sopim04g074700.0.1  54 KRRLRVDQVQALEKIFEVDNKLDPDRKVKIAQELGLQPRQIAIWFQNRRARWK 106
                         4567889*********************************************9 PP

2HD-ZIP_I/II1247.1e-4053143292
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         kkrrl  +qv++LE+ Fe ++kL+p+rKv++a+eLglqprq+a+WFqnrRAR+ktkqlE+dy+ Lk++y+al+++ +++e+e+e L +elk
  Sopim04g074700.0.1  53 KKRRLRVDQVQALEKIFEVDNKLDPDRKVKIAQELGLQPRQIAIWFQNRRARWKTKQLERDYNILKSNYEALQHNYTKVEQEKEGLITELK 143
                         9*************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.32548108IPR001356Homeobox domain
SuperFamilySSF466893.98E-1949110IPR009057Homeodomain-like
SMARTSM003895.0E-1951112IPR001356Homeobox domain
CDDcd000864.11E-1753109No hitNo description
PfamPF000462.4E-1654106IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.6E-2059106IPR009057Homeodomain-like
PRINTSPR000312.4E-57988IPR000047Helix-turn-helix motif
PROSITE patternPS00027083106IPR017970Homeobox, conserved site
PRINTSPR000312.4E-588104IPR000047Helix-turn-helix motif
PfamPF021835.2E-15108149IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MKRFSFSDSS GKLLYPTEEK NTENLGYSNE FQAMLDGLED EDGIEESGCG TGKKRRLRVD  60
QVQALEKIFE VDNKLDPDRK VKIAQELGLQ PRQIAIWFQN RRARWKTKQL ERDYNILKSN  120
YEALQHNYTK VEQEKEGLIT ELKGLKEKLG EETLLSPVFQ RPQEILNKLK NSSDFVDSKD  180
GSSDSDSSGV MNEETYNIST LNYQQLMPKV SSYSNSLDHL SLSSSTYTQL MDPRASNSTS  240
SSMRAYNNNN NNNDNNNSNN QQQQQAVGRI EEQNGFTTED SCNIYSVDQA PNLYWVGAWL  300
LGAYQTPCGG *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1100108RRARWKTKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankY173060.0Y17306.1 Lycopersicon esculentum mRNA for homeodomain protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015158857.10.0PREDICTED: homeobox-leucine zipper protein ATHB-6-like
TrEMBLK4BU080.0K4BU08_SOLLC; Uncharacterized protein
STRINGSolyc04g074700.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA129391620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.12e-39homeobox protein 16